Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Calcitonin (chicken)
pr

Calcitonin (chicken)

BGC Id:541611252826
CAS No:100016-62-4
Synonyms:cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1–7] ; calcitonin, chicken ; calcitonin (salmon),2-l-alanine-3-l-serine-26-l-aspartic acid-27-l-valine-29-l-alanine- ; chicken thyrocalcitonin ; h-cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 ; caslstcvlgklsqelhklqtyprtdvgagtp-nh2 ; caslstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7) ; h-cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 (disulfide bridge: 1-7) ; 1,2-dithia-5,8,11,14,17,20-hexaazacyclotricosane, cyclic peptide deriv. ; thyrocalcitonin from chicken ; calcitonin (chicken)(9ci) ; chicken calcitonin
Molecular Formula:C145H240 N42 O46 S2
Molecular Weight:3371.84
EINECS:
Structural Formula

Verified providers in 2025

The following 2 notable providers have been checked and can be recommended.
The last intensive check and update was carried out on 2025/10/30.

Identify

Synonyms:
cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1–7] ; calcitonin, chicken ; calcitonin (salmon),2-l-alanine-3-l-serine-26-l-aspartic acid-27-l-valine-29-l-alanine- ; chicken thyrocalcitonin ; h-cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 ; caslstcvlgklsqelhklqtyprtdvgagtp-nh2 ; caslstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7) ; h-cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 (disulfide bridge: 1-7) ; 1,2-dithia-5,8,11,14,17,20-hexaazacyclotricosane, cyclic peptide deriv. ; thyrocalcitonin from chicken ; calcitonin (chicken)(9ci) ; chicken calcitonin
CAS:
100016-62-4
EINECS:
Molecular Formula:
C145H240 N42 O46 S2
MDL:

Properties

Molecular Weight:
3371.84 g·mol−1

Suppliers

BIOZOL Diagnostica Vertrieb GmbH

Company type: Supplier of chemical products
Chemos®, a subsidiary of BIOZOL Diagnostica Vertrieb GmbH, is a leading supplier of ready to use solutions for the lab and chemical industry. We are producing reagents and standards for the analytical lab and supplying raw materials for the chemical and pharmaceutical industry. The base of our solutions are a portfolio of ~ 200.000 raw materials where ~ 50.000 are already available for R+D ready to order in our shop. We are supplier of N-Methyl-8-azabicyclo[3.2.1]octan-3-ol. We are supplying and producing lab quantities from tiny qua ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

BuGuCh & Partners

Company type: Producer
Country: Germany
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...

Safety Information

Hazard Classes:
Storage temperature:
-15°C



The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 100016-62-4?

In addition to the providers presented here for Calcitonin (chicken) with the CAS number 100016-62-4, there are other 5 providers with slightly different product names available for this CAS number.

+2 additional providers that we know from the past
+1 additional providers that we know from the past
+1 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2026 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.