Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » GRF (1-29) amide (human)
pr

GRF (1-29) amide (human)

BGC Id:751612673794
CAS No:86168-78-7
Synonyms:yadaiftnsyrkvlgqlsarkllqdimsr-nh2 ; ghrf (1-29), amide, human ; growth hormone releasing factor*fragment 1-29 ami ; grf (1-29) amide (human) sermorelin ; grf (1-29) amide (human) ; green tea powdered extract ; sermorelin aceta ; sermorelin acetate ; somatoliberin fragment 1-29 amide, human ; sermorelin
Molecular Formula:C149H246N44O42S
Molecular Weight:3357.88
EINECS:
Structural Formula

The most competitive supplier in 2025

The following notable provider has been checked and can be recommended.
Chemical-Suppliers
BuGuCh & Partners
Company type: Producer
Country: Germany
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production site ...
The last intensive check and update was carried out on 2025/10/30.

Identify

Synonyms:
yadaiftnsyrkvlgqlsarkllqdimsr-nh2 ; ghrf (1-29), amide, human ; growth hormone releasing factor*fragment 1-29 ami ; grf (1-29) amide (human) sermorelin ; grf (1-29) amide (human) ; green tea powdered extract ; sermorelin aceta ; sermorelin acetate ; somatoliberin fragment 1-29 amide, human ; sermorelin
CAS:
86168-78-7
EINECS:
Molecular Formula:
C149H246N44O42S
MDL:
MFCD00076559

Properties

Molecular Weight:
3357.88 g·mol−1

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C



The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 86168-78-7?

In addition to the providers presented here for GRF (1-29) amide (human) with the CAS number 86168-78-7, there are other 70 providers with slightly different product names available for this CAS number.

Shandong Ench Chemical Co.,Ltd | Hangzhou Zhongqi Chem Co., Ltd | Nantong Xindao Biotech Ltd | Leap Chem Co., Ltd | Skyrun Industrial Co., Ltd. | BuGuCh & Partners +31 additional providers that we know from the past
Wuhan PharmChem Co., LTD. | Simagchem Corporation | Shandong Minglang Chemical Co., Ltd | Xiamen Equation Chemical Co.,Ltd | BIOZOL Diagnostica Vertrieb GmbH | BuGuCh & Partners +19 additional providers that we know from the past
+1 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.