|
|
|
Amyloid b-Protein (1-38)
Synonyms: beta-amyloid (1-38) | h-asp-ala-glu-phe-arg-his-asp-ser-gly-tyr-glu-val-his-his-gln-lys-leu-val-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-oh | amyloid b-protein fragment 1-38 | amyloid beta-protein (1-38) | amyloid beta-protein fragment 1-38 | amyloid β protein fragment 1-38 | daefrhdsgyevhhqklvffaedvgsnkgaiiglmvgg | amyloid b-protein (1-38)
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is supplier for Amyloid b-Protein (1-38). The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. We sell Tyrosinase (243-251) (human) as well. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Specification
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as Amyloid b-Protein (1-38)
For the following products supplier are listed below:
Amyloid beta-Protein (1-38)
The following companies are not suppliers of Amyloid b-Protein (1-38) . This companies are suppliers for equal products with the same CAS number. CAS: 131438-74-9
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We are seller of 7-(2-Oxopropoxy)-2,3-dihydro-1H-cyclopenta[c]chromen-4-one.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
|
|
How do you find
new customers?
click here
BioClot GmbH
BioClot is a leading manufacturer and distributor specialising in quality Animal Blood Serum and re
Chemtour Biotech Co., L
Founded in 2014, Chemtour is specializing in providing pharmaceutical raw materials and chemicals f
Hangzhou Proserre Chemi
Hangzhou Proserre Chemical Co., LTD established in Dec 2013 is a marketing, contract manufacturing,
Anhui Cheer-Our Medical
ANHUI CHEER-OUR MEDICAL TECHNOLOGY CO.,LTD is one company mainly manufacturing, developing and supp
Xi´an SR Bio-Engineerin
Xi'an SR Bio-Engineering Co., Ltd established in 2009, is an expert in the field of biochemistry, p
Xperio Impex
Xperio Impex is a global supplier of specialty & industrial chemicals based in New Delhi, India
|
