Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » H-His-Ser-Asp-Gly-Ile-Phe-Thr-...
pr

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2

BGC Id:495054985866
CAS No:127317-03-7
Synonyms:human pacap-(1-27) ; 3: pn:us20050203009 seqid: 3 claimed protein ; l-leucinamide, l-histidyl-l-seryl-l-a-aspartylglycyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-a-aspartyl-l-seryl-l-tyrosyl-l-seryl-l-arginyl-l-tyrosyl-l-arginyl-l-lysyl-l-glutaminyl-l-methionyl-l-alanyl-l-valyl-l-lysyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-alanyl-l-valyl- ; vasoactiveintestinal octacosapeptide (pig),4-glycine-5-l-isoleucine-9-l-serine-11-l-serine-13-l-tyrosine-24-l-alanine-25-l-alanine-26-l-valine-27-l-leucinamide-28-de-l-aspartamide- ; 3: pn: wo2004048401 seqid: 3 claimedprotein ; pacap 27 amide, ovine ; pacap (1-27), human, ovine, rat ; pacap-27 (human, ovine, rat) ; 22: pn: wo2009099763 seqid: 659 claimed protein ; 30: pn: wo2007058336 seqid: 30claimed protein ; pituitary adenylatecyclase-activating peptide-27 (human) (9ci) ; powdered posterior pitultary ; 37: pn: jp2004315436 seqid: 23 claimed sequence ; pacap-27 ; pacap (1-27) amide ; m-pacap ; human pacap-27 ; pacap 1-27 ; ovine pacap 27 ; peptide pacap 27 (sheep) ; pituitary adenylate cyclase-activatingpolypeptide-27 (human) ; pituitary adenylatecyclase-activating peptide-27 (sheep) ; pacap (1-27) (human, sheep, rat) ; hsdgiftdsysryrkqmavkkylaavl-nh2 ; rat pacap-27
Molecular Formula:C142H224 N40 O39 S
Molecular Weight:3147.61
EINECS:
Structural Formula

Verified providers in 2026

The following notable provider has been checked and can be recommended.
Chemical-Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
Phone: +852-30606658
Country: P.R.China
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer se ...
The last intensive check and update was carried out on 2026/01/15.

Identify

Synonyms:
human pacap-(1-27) ; 3: pn:us20050203009 seqid: 3 claimed protein ; l-leucinamide, l-histidyl-l-seryl-l-a-aspartylglycyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-a-aspartyl-l-seryl-l-tyrosyl-l-seryl-l-arginyl-l-tyrosyl-l-arginyl-l-lysyl-l-glutaminyl-l-methionyl-l-alanyl-l-valyl-l-lysyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-alanyl-l-valyl- ; vasoactiveintestinal octacosapeptide (pig),4-glycine-5-l-isoleucine-9-l-serine-11-l-serine-13-l-tyrosine-24-l-alanine-25-l-alanine-26-l-valine-27-l-leucinamide-28-de-l-aspartamide- ; 3: pn: wo2004048401 seqid: 3 claimedprotein ; pacap 27 amide, ovine ; pacap (1-27), human, ovine, rat ; pacap-27 (human, ovine, rat) ; 22: pn: wo2009099763 seqid: 659 claimed protein ; 30: pn: wo2007058336 seqid: 30claimed protein ; pituitary adenylatecyclase-activating peptide-27 (human) (9ci) ; powdered posterior pitultary ; 37: pn: jp2004315436 seqid: 23 claimed sequence ; pacap-27 ; pacap (1-27) amide ; m-pacap ; human pacap-27 ; pacap 1-27 ; ovine pacap 27 ; peptide pacap 27 (sheep) ; pituitary adenylate cyclase-activatingpolypeptide-27 (human) ; pituitary adenylatecyclase-activating peptide-27 (sheep) ; pacap (1-27) (human, sheep, rat) ; hsdgiftdsysryrkqmavkkylaavl-nh2 ; rat pacap-27
CAS:
127317-03-7
EINECS:
Molecular Formula:
C142H224 N40 O39 S
MDL:

Properties

Molecular Weight:
3147.61 g·mol−1
download Download Molfile for :
PACAP 1-27

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 127317-03-7?

In addition to the providers presented here for H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 with the CAS number 127317-03-7, there are other 18 providers with slightly different product names available for this CAS number.

Shandong Ench Chemical Co.,Ltd +1 additional providers that we know from the past
+1 additional providers that we know from the past
BOC Sciences
+1 additional providers that we know from the past
Dayang Chem (Hangzhou) Co.,Ltd. | BIOZOL Diagnostica Vertrieb GmbH +2 additional providers that we know from the past
+4 additional providers that we know from the past
+2 additional providers that we know from the past
+3 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2026 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.