Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » PACAP-27 (human, mouse, ovine,...
pr

PACAP-27 (human, mouse, ovine, porcine, rat)

BGC Id:333093474287
CAS No:127317-03-7
Synonyms:l-leucinamide, l-histidyl-l-seryl-l-a-aspartylglycyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-a-aspartyl-l-seryl-l-tyrosyl-l-seryl-l-arginyl-l-tyrosyl-l-arginyl-l-lysyl-l-glutaminyl-l-methionyl-l-alanyl-l-valyl-l-lysyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-alanyl-l-valyl- ; powdered posterior pitultary ; 22: pn: wo2009099763 seqid: 659 claimed protein ; peptide pacap 27 (sheep) ; pacap (1-27), human, ovine, rat ; 3: pn:us20050203009 seqid: 3 claimed protein ; human pacap-27 ; pituitary adenylatecyclase-activating peptide-27 (sheep) ; pacap (1-27) (human, sheep, rat) ; hsdgiftdsysryrkqmavkkylaavl-nh2 ; 3: pn: wo2004048401 seqid: 3 claimedprotein ; pacap 27 amide, ovine ; rat pacap-27 ; vasoactiveintestinal octacosapeptide (pig),4-glycine-5-l-isoleucine-9-l-serine-11-l-serine-13-l-tyrosine-24-l-alanine-25-l-alanine-26-l-valine-27-l-leucinamide-28-de-l-aspartamide- ; 37: pn: jp2004315436 seqid: 23 claimed sequence ; pacap (1-27) amide ; m-pacap ; pituitary adenylate cyclase-activatingpolypeptide-27 (human) ; pacap-27 (human, ovine, rat) ; pacap-27 ; ovine pacap 27 ; pacap 1-27 ; 30: pn: wo2007058336 seqid: 30claimed protein ; pituitary adenylatecyclase-activating peptide-27 (human) (9ci) ; human pacap-(1-27)
Molecular Formula:C142H224 N40 O39 S
Molecular Weight:3147.61
EINECS:
Structural Formula

Identify

Synonyms:
l-leucinamide, l-histidyl-l-seryl-l-a-aspartylglycyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-a-aspartyl-l-seryl-l-tyrosyl-l-seryl-l-arginyl-l-tyrosyl-l-arginyl-l-lysyl-l-glutaminyl-l-methionyl-l-alanyl-l-valyl-l-lysyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-alanyl-l-valyl- ; powdered posterior pitultary ; 22: pn: wo2009099763 seqid: 659 claimed protein ; peptide pacap 27 (sheep) ; pacap (1-27), human, ovine, rat ; 3: pn:us20050203009 seqid: 3 claimed protein ; human pacap-27 ; pituitary adenylatecyclase-activating peptide-27 (sheep) ; pacap (1-27) (human, sheep, rat) ; hsdgiftdsysryrkqmavkkylaavl-nh2 ; 3: pn: wo2004048401 seqid: 3 claimedprotein ; pacap 27 amide, ovine ; rat pacap-27 ; vasoactiveintestinal octacosapeptide (pig),4-glycine-5-l-isoleucine-9-l-serine-11-l-serine-13-l-tyrosine-24-l-alanine-25-l-alanine-26-l-valine-27-l-leucinamide-28-de-l-aspartamide- ; 37: pn: jp2004315436 seqid: 23 claimed sequence ; pacap (1-27) amide ; m-pacap ; pituitary adenylate cyclase-activatingpolypeptide-27 (human) ; pacap-27 (human, ovine, rat) ; pacap-27 ; ovine pacap 27 ; pacap 1-27 ; 30: pn: wo2007058336 seqid: 30claimed protein ; pituitary adenylatecyclase-activating peptide-27 (human) (9ci) ; human pacap-(1-27)
CAS:
127317-03-7
EINECS:
Molecular Formula:
C142H224 N40 O39 S
MDL:

Properties

Molecular Weight:
3147.61 g·mol−1
download Download Molfile for :
PACAP 1-27

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C



The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 127317-03-7?

In addition to the providers presented here for PACAP-27 (human, mouse, ovine, porcine, rat) with the CAS number 127317-03-7, there are other 19 providers with slightly different product names available for this CAS number.

Shandong Ench Chemical Co.,Ltd +1 additional providers that we know from the past
+1 additional providers that we know from the past
BOC Sciences
+1 additional providers that we know from the past
Dayang Chem (Hangzhou) Co.,Ltd. | BIOZOL Diagnostica Vertrieb GmbH +2 additional providers that we know from the past
+2 additional providers that we know from the past
+3 additional providers that we know from the past
Leap Chem Co., Ltd +4 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2026 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.