Oxyntomodulin
Synonyms: hsqgtftsdyskyldsrraqdfvqwlmntkrnknnia | oxyntomodulin (porcine) | glucagon 37 | oxyntomodulin | enteroglucagon | m.w. 4421.86 c192h295n59o60s | enteroglucagon | glucagon (1-37) (porcine) | h-his-ser-gln-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-gln-asp-phe-val-gln-trp-leu-met-asn-thr-lys-arg-asn-lys-asn-asn-ile-ala-oh | glucagon 1-37
List of Suppliers
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. Ethyl 2-bromo-2,2-difluoroacetate is also served by BuGuCh & Partners. BuGuCh & Partners is supplier for Oxyntomodulin. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Most viewed
Within the past time user are also interested in the following chemicals.
DL-alpha-Phosphatidylcholine dipalmitoyl
Suppliers and manufactures - with identical CAS number as Oxyntomodulin
For the following products supplier are listed below:
Glucagon (1-37) (porcine)
Oxyntomodulin (porcine, bovine)
The following companies are not suppliers of Oxyntomodulin . This companies are suppliers for equal products with the same CAS number. CAS: 62340-29-8
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We are supplier of (3S)-4-Acetyl-1,3-dihydro-1-oxo-5-[(1S)-1,3,3-trimethylcyclohexyl]isobenzofuran-3-ol acetate.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
polypeptide.ltd
Company type: Laboratory supplier
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the Fine Chemical Industrial Park of Zhangpan Town, Xuchang, Henan Province, with 10 million square meters, total assets of 10 million US dollars, and more than 100 employees.
Shangke Chemical is a high-tech enterprise specializing in active pharmaceutical intermediates (APIs). Glepaglutide is also served by polypeptide.ltd. To control the quality during production, a large number of experienced professionals, a first-class pr ...
Country: P.R.China
Phone: +86 152 1950 7320
Telefax:
Related products:
Oxyntomodulin (human, mouse, rat); OXM (human, mouse, rat), Preproglucagon (53-89) (human, mouse, rat), Proglucagon (33-69) (human, mouse, rat), Glucagon-37 (human, mouse, rat)
Oxyntomodulin (bovine, dog, porcine); OXM (bovine, dog, porcine), Preproglucagon (53-89) (bovine, dog, porcine), Proglucagon (33-69) (bovine, dog, porcine), Glucagon-37 (bovine, dog, porcine)
|
